PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00076.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 378aa    MW: 42821.9 Da    PI: 9.7688
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00076.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.85.2e-5011271128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              + pGfrF+Ptd+el+++yLkkk+eg++ ++ evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWka
  Sme2.5_00076.1_g00002.1   1 MFPGFRFSPTDDELISYYLKKKLEGSDKRV-EVIAEVEIWKHEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKA 85 
                              579************************999.99***************667777899***************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgk+++v+s +++ +g+k+tLvf+ grapkg++t+W+mhey +
  Sme2.5_00076.1_g00002.1  86 TGKERNVKS-GSNIIGTKRTLVFHAGRAPKGQRTQWIMHEYCM 127
                              *********.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.0391145IPR003441NAC domain
SuperFamilySSF1019415.49E-552144IPR003441NAC domain
PfamPF023652.8E-263126IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MFPGFRFSPT DDELISYYLK KKLEGSDKRV EVIAEVEIWK HEPWDLPAKS VIQSDNEWFF  60
FSPRGRKYPN GSQSKRATES GYWKATGKER NVKSGSNIIG TKRTLVFHAG RAPKGQRTQW  120
IMHEYCMIGN ANFQDSMVIC RLRKNSEFHL NDTPRNQRNQ LVATDSATAM SGAGQLGSLE  180
LVEVADCCSK EGSSSFHSLS VEQIDSGSDS EKPTKEFSQH NSSGHFKDCD IEDDWFADIM  240
KDDIIKLDDS SLNPRPISMI PVRPETSELS NHEGQAAMSS VVPFQGTANR RLRLVREIVA  300
KCRVKGSESY KAIKKNKVGV GTISSSKWLR NMFSVKWMRQ HLIPVCLVTL ILLVVLLSLL  360
GVSQQFKWRS RLLILARR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-44314217165Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-126HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361089.10.0PREDICTED: NAC domain-containing protein 89-like isoform X1
SwissprotQ9XIN72e-83NAC40_ARATH; NAC domain-containing protein 40
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.15e-78NTM1-like 8